Scientific journal
Advances in current natural sciences
ISSN 1681-7494
"Перечень" ВАК
ИФ РИНЦ = 0,791

Пептиды слияния - фрагменты вирусных белков, состоящие из 20-25 аминокислот, способные вызывать слияние липидных и биологических мембран [1]. При изучении этих процессов удобно работать с водорастворимыми аналогами. Нами сконструирован аналог F31, состоящий из 31-го аминокислотного остатка: glfgaiagfieggwtgmidgwygygggkkkk.

С-концевой фрагмент GCGKKK обеспечивает водорастворимостиь пептида, а N-концевая часть (остатки 1-24) соответствует пептиду слияния из гемагглютинина (штамм A/PR/8/34). В пептиде имеется только один остаток глутаминовой кислоты (Glu11). Цель данной работы - изучить влияние пептида F31 на фосфолипидные липосомы при различных состояниях ионизации этого остатка. С учётом данных по величинам рКа остатков Glu в пептидах слияния, находящихся в мембранном окружении, есть основания считать, что при изменении рН от 7 до 4 с большой долей вероятности происходит протонирование боковой карбоксильной группы этого остатка. Поэтому нами взяты эти значения рН как такие, при которых остаток полностью заряжен (рН 7) и нейтрален (рН 4), соответственно. Фосфолипидные липосомы формировались из анионного фосфолипида диолеоилфосфатидилглицерина (ДОФГ). Т.к. заряд пептида в целом положителен при обоих значениях рН (4 и 7), это обеспечивает эффективное связывание с пловерхностью липосом за счёт электростатического притяжения. Следовательно, изменение характера вляиния пептида на липосомы при изменении рн от 7 до 4 будет означать изменение характера гидрофобного взаимодействия пептида с липосомами, вероятно, за счёт изменения глубины проникновения пептида в фосфолипидный бислой и/или характера ассоции пептидов на липосомах.

Наиболее удобным методом для исследования взаимодействий липид/пептид является метод 31P-ЯМР спектроскопии широких линий. Данный метод позволяет работать с бислойными мультиламеллярными липосомами, которые более адекватно моделирует биологическую мембрану. Показано, что форма линии 31P-ЯМР спектров мембран чувствительна к анизотропным движениям молекул фосфолипидов[2, 3], что позволяет следить за изменениями состояния модельной мембраны под воздействием пептида.

Для изучения рН-зависимости взаимодействия были проведены серии экспериментов при рН 4 и 7. Проанализировав полученные 31Р-ЯМР спектры с помощью разработанной нами программы P-FIT [4], были получены зависимости параметров, характеризующих состояние бислоя в зависимости от соотношения липид/пептид.

При рН 4 наблюдается значительное влияние пептида на состояние бислоя. Так, при последовательном добавлении пептида, начиная с соотношения липид/пептид 40:1 происходит формирование второй анизотропной составляющей. Данная составляющая характеризуется уменьшенным значением анизотропии химического сдвига а также уменьшенным значением степени деформации липосом магнитным полем спектрометра, что связано с уменьшением эластичности мембраны. При уменьшением соотношения липид/пептид от 40:1 до 15:1 происходит рост вклада этой составляющей от ~15% до ~50%. Также стоит отметить что начиная с соотношения липид/пептид 30:1 становится значительным вклад от изотропной составляющей, которая соответствует разрушенным липосомам. Величина этой составляющей растёт пропорционально количеству добавленного пептида и достигает значений 3-4%.

При рН 7 картина взаимодействия существенно иная: Во всём изученном диапазоне значений липид/пептид(от 50 до 15) не наблюдалось формирование дополнительных состояний модельного липидного бислоя. В то время как наблюдалось небольшое изменение параметров эластичности бислоя.

Таким образом, анализ влияния пептида на бислои ДОФГ при выбранных значениях рН подтверждает предположение о существенной роли ионогенного сотояния состояния остатка Glu11 во взаимодействии пептида слияния этого типа с липидным бислоем.

Благодарность:

Выражаем признательность РФФИ за финансовую поддержку, грант № 02-48882.

СПИСОК ЛИТЕРАТУРЫ

  1. Dubovskii, P.V., Li, H., Takahashi, S., Arseniev, A.S., and Akasaka, K.Protein Sci., 2000 V. 9, P. 786-798.
  2. Seelig J. Biochim. Biophys. Acta. 1978. V. 515. P. 105-140.
  3. Brumm T., Mops A., Dolainsky C., Bruckner S., Bayerl T.M. Biophys. J. 1992. V. 61. P. 1018-1024.
  4. Dubovskii P.V., Lesovoy D.M., Dubinnyi M.A., Utkin Y.N., Arseniev A.S. // Eur. J. Biochem. 2003. V. 270. P. 2038-2046.